PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00105.1_g00017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CO-like
Protein Properties Length: 377aa    MW: 41112.1 Da    PI: 5.4516
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00105.1_g00017.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.71.8e-06444539
                 zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                             +C+ ++e++   +C+++  +lC +C  + H+       H++
  Rsa1.0_00105.1_g00017.1  4 MCDFCGEQRSMVYCRSDAACLCLSCDRSVHSAnalskrHSR 44
                             6*****************************65677777765 PP

2zf-B_box22.72.1e-074695441
                 zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg............Htvvp 41
                              +C++++ ++++  C + ++ lC++C  ++H++            H++++
  Rsa1.0_00105.1_g00017.1 46 LVCERCNAQPATVRCVEERVSLCQNCDWSGHNNnnnnssssssnnHKRQT 95
                             68*****************************8877788888888887765 PP

3CCT62.51.3e-21320363144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              R++a++RYkeK+k RkF+K++rY+sRKa+A+ R RvKGrFvk+ 
  Rsa1.0_00105.1_g00017.1 320 RNNAVMRYKEKKKARKFDKTVRYASRKARADVRRRVKGRFVKAG 363
                              99***************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.798147IPR000315B-box-type zinc finger
CDDcd000211.28E-7447No hitNo description
SMARTSM003361.1E-8447IPR000315B-box-type zinc finger
PROSITE profilePS501199.0154396IPR000315B-box-type zinc finger
CDDcd000212.46E-54776No hitNo description
SMARTSM003360.964896IPR000315B-box-type zinc finger
PfamPF062032.5E-16320362IPR010402CCT domain
PROSITE profilePS5101715.18320362IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MGYMCDFCGE QRSMVYCRSD AACLCLSCDR SVHSANALSK RHSRTLVCER CNAQPATVRC  60
VEERVSLCQN CDWSGHNNNN NNSSSSSSNN HKRQTISCYS GCPSSSELAS IWSFCLELAG  120
QSGCEQEMGL MNIDDDGQTN QNCNDDDKKD GAGGGSSLRP ETSSAAPATS SFPKEVRVCE  180
DDFYGNLGMD EVDLALENYE ELFGTAFNTS GELFGQGGID CLFQKHHQAA AAAAPEGGNL  240
VQPAESNDDS FMSSKTEPII CFTSKPAHSH NISFSGVTGD SSAGDFQECG ASSSMQLSGE  300
PPWYPQTSQD NNACSQSVTR NNAVMRYKEK KKARKFDKTV RYASRKARAD VRRRVKGRFV  360
KAGEAYDYDP LTPTRSY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013750600.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_013750599.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
SwissprotQ9SSE50.0COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A078HDR00.0A0A078HDR0_BRANA; BnaA05g29980D protein
STRINGBra029666.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16822786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.40.0CONSTANS-like 9